PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006676.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MIKC_MADS
Protein Properties Length: 273aa    MW: 30775.3 Da    PI: 9.8253
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006676.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.52.7e-312474151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krien++nrqvtfskRrng++KKA+ELSvLCdaeva+i+fss+g+lyeys+
  Do006676.1 24 KRIENNTNRQVTFSKRRNGLIKKAYELSVLCDAEVALIVFSSRGRLYEYSN 74
                79***********************************************95 PP

2K-box93.43.8e-3110218616100
       K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                 + qqe+akL+++i++Lq+++Rhl+G+++e+LslkeL+qLe++Lek+++kiR++K+ell ++i+++ k+e elq+++++Lr+k+ee
  Do006676.1 102 NAQQESAKLRNQIQMLQNTNRHLVGDSVENLSLKELKQLESRLEKGISKIRARKSELLSAEINYMVKRETELQNDHMNLRTKIEE 186
                 679********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-411675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.0621676IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-331789IPR002100Transcription factor, MADS-box
CDDcd002652.81E-451793No hitNo description
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-321838IPR002100Transcription factor, MADS-box
PfamPF003194.2E-272572IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-323853IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-325374IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.217100190IPR002487Transcription factor, K-box
PfamPF014861.3E-22102184IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MYVKNLLAFS RDLSTMGRGR IEIKRIENNT NRQVTFSKRR NGLIKKAYEL SVLCDAEVAL  60
IVFSSRGRLY EYSNNSVKAT IERYKKAHAV GSSSGPPLLE LNAQQESAKL RNQIQMLQNT  120
NRHLVGDSVE NLSLKELKQL ESRLEKGISK IRARKSELLS AEINYMVKRE TELQNDHMNL  180
RTKIEEGEQQ LQQVTVARSA AAAAAGVELN PFLQMDTKCF FPTGPFGALD MKCFFPGGLQ  240
MLEAHRQMLT TELNLGYQLA PPSADAINNP HQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-201684169Myocyte-specific enhancer factor 2B
1tqe_Q1e-201684169Myocyte-specific enhancer factor 2B
1tqe_R1e-201684169Myocyte-specific enhancer factor 2B
1tqe_S1e-201684169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZMU315220.0U31522.1 Zea Mays MADS box protein (ZmOV23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960786.11e-173PREDICTED: MADS-box transcription factor 13-like
SwissprotQ2QW531e-116MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLK3Z8W11e-173K3Z8W1_SETIT; Uncharacterized protein
STRINGSi022981m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-78MIKC_MADS family protein